PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G259600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 312aa    MW: 34604.4 Da    PI: 5.4232
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G259600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.6e-092312642255
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +yps+ e++ LA+++gL+ +q+ +WF N+R ++
  Brast02G259600.1.p 231 WPYPSELEKAALAESTGLDGKQINNWFINQRKRH 264
                         69*****************************885 PP

2ELK25.82.5e-09184205122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK +Ll KYsgyL sL+  +s
  Brast02G259600.1.p 184 ELKSHLLSKYSGYLTSLWRDLS 205
                         9*****************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-185094IPR005540KNOX1
PfamPF037901.4E-195192IPR005540KNOX1
SMARTSM012563.8E-2598149IPR005541KNOX2
PfamPF037911.8E-21103148IPR005541KNOX2
PfamPF037891.6E-8184205IPR005539ELK domain
SMARTSM011887.4E-6184205IPR005539ELK domain
PROSITE profilePS512139.271184204IPR005539ELK domain
PROSITE profilePS5007112.26204267IPR001356Homeobox domain
SuperFamilySSF466891.28E-17205273IPR009057Homeodomain-like
SMARTSM003891.5E-11206271IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.8E-25209267IPR009057Homeodomain-like
CDDcd000867.92E-12213267No hitNo description
PfamPF059201.3E-15224263IPR008422Homeobox KN domain
PROSITE patternPS000270242265IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDQLPLPAGG SKASTPFYLT LDNTTTSTSP PAPAPGSEPS TRSNHERGTD TIKAKIMSHP  60
LYPALLRAFI ECQKVGAPQE VVGRLCALAG ELESGSGDRR QDSLDPELDE FMETYCDVLV  120
RYKQDLTTPI QEADQFFRDM EAQMDSFTLD DNSCGGDGSS EDEQEAGDAA GLPEITSQCA  180
EDNELKSHLL SKYSGYLTSL WRDLSKKKKK GKLPRDARQK LLHWWQLHYR WPYPSELEKA  240
ALAESTGLDG KQINNWFINQ RKRHWKPTPP AVEYRSQQQQ PHYGASSSTS AAFLTEGHYF  300
TGGSAYPPRG P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352051e-91BT035205.1 Zea mays full-length cDNA clone ZM_BFb0044N12 mRNA, complete cds.
GenBankBT0406221e-91BT040622.1 Zea mays full-length cDNA clone ZM_BFc0104L02 mRNA, complete cds.
GenBankKJ7275711e-91KJ727571.1 Zea mays clone pUT5431 HB transcription factor (HB110) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559594.10.0PREDICTED: homeobox protein knotted-1-like 4
SwissprotQ75LX71e-147KNOS4_ORYSJ; Homeobox protein knotted-1-like 4
TrEMBLI1GPN50.0I1GPN5_BRADI; Uncharacterized protein
STRINGBRADI1G12690.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.13e-79KNOTTED-like from Arabidopsis thaliana